| Identification |
| HMDB Protein ID
| HMDBP12043 |
| Secondary Accession Numbers
| None |
| Name
| Zinc transporter 9 |
| Synonyms
|
- ZnT-9
- Human embryonic lung protein
- Solute carrier family 30 member 9
- HuEL
|
| Gene Name
| SLC30A9 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Plays a role in the p160 coactivator signaling pathway that mediates transcriptional activation by nuclear receptors (By similarity). Plays a role in transcriptional activation of Wnt-responsive genes (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| transcription, DNA-dependent |
| nucleotide-excision repair |
| zinc ion transport |
| Cellular Component |
| integral to membrane |
| nucleus |
| cytoskeleton |
| Molecular Function |
| nucleotide binding |
| sequence-specific DNA binding transcription factor activity |
| cation transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 4 |
| Locus
| 4p13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 63514.525 |
| Theoretical pI
| 8.33 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|57164948|ref|NP_006336.3| zinc transporter 9 [Homo sapiens]
MLPGLAAAAAHRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNMVPCSHPYIGT
LSQVKLYSTN
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6PML9 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:1329 |
| References |
| General References
| Not Available |