| Identification |
| HMDB Protein ID
| HMDBP12042 |
| Secondary Accession Numbers
| None |
| Name
| Zinc transporter 8 |
| Synonyms
|
- ZnT-8
- Solute carrier family 30 member 8
|
| Gene Name
| SLC30A8 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| positive regulation of insulin secretion |
| response to glucose stimulus |
| response to interleukin-1 |
| response to interferon-gamma |
| insulin secretion |
| regulation of sequestering of zinc ion |
| sequestering of zinc ion |
| regulation of vesicle-mediated transport |
| Cellular Component |
| integral to membrane |
| plasma membrane |
| secretory granule membrane |
| transport vesicle membrane |
| Molecular Function |
| zinc ion binding |
| protein homodimerization activity |
| zinc ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 8 |
| Locus
| 8q24.11 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 35052.755 |
| Theoretical pI
| 6.96 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|289803003|ref|NP_001166282.1| zinc transporter 8 isoform b [Homo sapiens]
MYHCHSGSKPTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLI
DLTSFLLSLF
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IWU4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20303 |
| References |
| General References
| Not Available |