| Identification |
| HMDB Protein ID
| HMDBP12041 |
| Secondary Accession Numbers
| None |
| Name
| Zinc transporter 7 |
| Synonyms
|
- ZnT-7
- Solute carrier family 30 member 7
- Znt-like transporter 2
|
| Gene Name
| SLC30A7 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Seems to facilitate zinc transport from the cytoplasm into the Golgi apparatus. Partly regulates cellular zinc homeostasis. Required with ZNT5 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Transports zinc into the lumens of the Golgi apparatus and the vesicular compartments where ALPs locate, thus, converting apoALPs to holoALPs. Required with ZNT5 and ZNT6 for the activation of TNAP (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| transmembrane transport |
| zinc ion transport |
| sequestering of zinc ion |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| cytoplasmic membrane-bounded vesicle |
| perinuclear region of cytoplasm |
| vesicle |
| Molecular Function |
| cation transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p21.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 41625.605 |
| Theoretical pI
| 6.941 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|222080086|ref|NP_001138356.1| zinc transporter 7 [Homo sapiens]
MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN
CLGLISDSFH
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8NEW0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:19306 |
| References |
| General References
| Not Available |