Hmdb loader
Identification
HMDB Protein ID HMDBP12040
Secondary Accession Numbers None
Name Zinc transporter 6
Synonyms
  1. ZnT-6
  2. Solute carrier family 30 member 6
Gene Name SLC30A6
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Zinc-efflux transporter which allocates the cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
transmembrane transport
zinc ion transport
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
cation transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2p22.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 55794.35
Theoretical pI 9.063
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|301898419|ref|NP_001180442.1| zinc transporter 6 isoform 1 [Homo sapiens]
MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIAL
TAYTYLTIFD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6NXT4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:19305
References
General References Not Available