| Identification |
| HMDB Protein ID
| HMDBP12040 |
| Secondary Accession Numbers
| None |
| Name
| Zinc transporter 6 |
| Synonyms
|
- ZnT-6
- Solute carrier family 30 member 6
|
| Gene Name
| SLC30A6 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Zinc-efflux transporter which allocates the cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| transmembrane transport |
| zinc ion transport |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| cation transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 2 |
| Locus
| 2p22.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 55794.35 |
| Theoretical pI
| 9.063 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|301898419|ref|NP_001180442.1| zinc transporter 6 isoform 1 [Homo sapiens]
MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIAL
TAYTYLTIFD
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6NXT4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:19305 |
| References |
| General References
| Not Available |