Hmdb loader
Identification
HMDB Protein ID HMDBP12039
Secondary Accession Numbers None
Name Zinc transporter 4
Synonyms
  1. ZnT-4
  2. Solute carrier family 30 member 4
Gene Name SLC30A4
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probably involved in zinc transport out of the cytoplasm, maybe by sequestration into an intracellular compartment.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
response to zinc ion
response to vitamin A
response to toxin
lactation
regulation of sequestering of zinc ion
zinc ion homeostasis
Cellular Component
integral to membrane
cytoplasmic membrane-bounded vesicle
late endosome
endosome membrane
Molecular Function
zinc ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 15
Locus 15q21.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 47482.24
Theoretical pI 6.587
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|21359890|ref|NP_037441.2| zinc transporter 4 [Homo sapiens]
MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPER
PVNGAHPTLQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O14863
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11015
References
General References Not Available