| Identification |
| HMDB Protein ID
| HMDBP12037 |
| Secondary Accession Numbers
| None |
| Name
| Zinc transporter 2 |
| Synonyms
|
- ZnT-2
- Solute carrier family 30 member 2
|
| Gene Name
| SLC30A2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Not Available |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| transmembrane transport |
| positive regulation of sequestering of zinc ion |
| Cellular Component |
| integral to membrane |
| cytoplasmic membrane-bounded vesicle |
| late endosome |
| endosome membrane |
| lysosomal membrane |
| Molecular Function |
| zinc ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p35.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 40563.575 |
| Theoretical pI
| 6.374 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|52352805|ref|NP_001004434.1| zinc transporter 2 isoform 1 [Homo sapiens]
MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPD
SHCDPKKGKA
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BRI3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11013 |
| References |
| General References
| Not Available |