Hmdb loader
Identification
HMDB Protein ID HMDBP12037
Secondary Accession Numbers None
Name Zinc transporter 2
Synonyms
  1. ZnT-2
  2. Solute carrier family 30 member 2
Gene Name SLC30A2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
transmembrane transport
positive regulation of sequestering of zinc ion
Cellular Component
integral to membrane
cytoplasmic membrane-bounded vesicle
late endosome
endosome membrane
lysosomal membrane
Molecular Function
zinc ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p35.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 40563.575
Theoretical pI 6.374
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|52352805|ref|NP_001004434.1| zinc transporter 2 isoform 1 [Homo sapiens]
MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPD
SHCDPKKGKA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9BRI3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11013
References
General References Not Available