Hmdb loader
Identification
HMDB Protein ID HMDBP12035
Secondary Accession Numbers None
Name Zinc transporter 10
Synonyms
  1. ZnT-10
  2. Solute carrier family 30 member 10
Gene Name SLC30A10
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May be involved in zinc transport out of the cell, being a zinc-efflux transporter (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
zinc ion transport
Cellular Component
integral to membrane
plasma membrane
Molecular Function
cation transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q41
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 52683.46
Theoretical pI 6.724
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|52351208|ref|NP_061183.2| zinc transporter 10 [Homo sapiens]
MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI
ARRPTRGFSA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6XR72
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25355
References
General References Not Available