Hmdb loader
Identification
HMDB Protein ID HMDBP12033
Secondary Accession Numbers None
Name Palmitoyltransferase ZDHHC9
Synonyms
  1. Zinc finger DHHC domain-containing protein 9
  2. Zinc finger protein 379
  3. Zinc finger protein 380
  4. DHHC-9
  5. DHHC9
Gene Name ZDHHC9
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS.
Pathways Not Available
Reactions
Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A details
GO Classification
Cellular Component
integral to membrane
endoplasmic reticulum membrane
Golgi membrane
Golgi apparatus
Molecular Function
metal ion binding
zinc ion binding
transferase activity, transferring acyl groups
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Xq26.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 40915.225
Theoretical pI 7.838
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|56682974|ref|NP_001008223.1| palmitoyltransferase ZDHHC9 [Homo sapiens]
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYL
AVQLSPAIPV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9Y397
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18475
References
General References Not Available