Hmdb loader
Identification
HMDB Protein ID HMDBP12030
Secondary Accession Numbers None
Name Palmitoyltransferase ZDHHC6
Synonyms
  1. Transmembrane protein H4
  2. Zinc finger DHHC domain-containing protein 6
  3. Zinc finger protein 376
  4. DHHC-6
Gene Name ZDHHC6
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Palmitoylates calnexin (CALX), which is required for its association with the ribosome-translocon complex and efficient folding of glycosylated proteins.
Pathways Not Available
Reactions
Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A details
GO Classification
Cellular Component
integral to membrane
endoplasmic reticulum membrane
Molecular Function
metal ion binding
zinc ion binding
transferase activity, transferring acyl groups
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10q25.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 47662.39
Theoretical pI 8.469
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|11968053|ref|NP_071939.1| palmitoyltransferase ZDHHC6 [Homo sapiens]
MGTFCSVIKFENLQELKRLCHWGPIIALGVIAICSTMAMIDSVLWYWPLHTTGGSVNFIM
LINWTVMILY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H6R6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:19160
References
General References Not Available