| Identification |
| HMDB Protein ID
| HMDBP12029 |
| Secondary Accession Numbers
| None |
| Name
| Palmitoyltransferase ZDHHC5 |
| Synonyms
|
- Zinc finger DHHC domain-containing protein 5
- Zinc finger protein 375
- DHHC-5
|
| Gene Name
| ZDHHC5 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Palmitoyl acyltransferase for the G-protein coupled receptor SSTR5. Also palmitoylates FLOT2 (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
|
| Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A |
details
|
|
| GO Classification
|
| Biological Process |
| protein palmitoylation |
| Cellular Component |
| integral to membrane |
| plasma membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| palmitoyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 11 |
| Locus
| 11q12.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 77543.97 |
| Theoretical pI
| 9.007 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|41152072|ref|NP_056272.2| palmitoyltransferase ZDHHC5 [Homo sapiens]
MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLA
NFSMATFMDP
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9C0B5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18472 |
| References |
| General References
| Not Available |