| Identification |
| HMDB Protein ID
| HMDBP12022 |
| Secondary Accession Numbers
| None |
| Name
| Putative palmitoyltransferase ZDHHC22 |
| Synonyms
|
- Zinc finger DHHC domain-containing protein 22
- DHHC-22
|
| Gene Name
| ZDHHC22 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Not Available |
| Pathways
|
Not Available
|
| Reactions
|
| Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A |
details
|
|
| GO Classification
|
| Cellular Component |
| integral to membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| transferase activity, transferring acyl groups |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 14 |
| Locus
| 14q24.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 29099.21 |
| Theoretical pI
| 9.255 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|145046234|ref|NP_777636.2| putative palmitoyltransferase ZDHHC22 [Homo sapiens]
MLALRLLNVVAPAYFLCISLVTFVLQLFLFLPSMREDPAAARLFSPALLHGALFLFLSAN
ALGNYVLVIQ
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8N966 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20106 |
| References |
| General References
| Not Available |