Hmdb loader
Identification
HMDB Protein ID HMDBP12021
Secondary Accession Numbers None
Name Palmitoyltransferase ZDHHC21
Synonyms
  1. Zinc finger DHHC domain-containing protein 21
  2. DHHC-21
Gene Name ZDHHC21
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane. This affects rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect that mediated by their nuclear receptor (By similarity).
Pathways Not Available
Reactions
Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A details
GO Classification
Biological Process
small molecule metabolic process
nitric oxide metabolic process
regulation of nitric-oxide synthase activity
hair follicle development
peptidyl-L-cysteine S-palmitoylation
sebaceous gland development
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
metal ion binding
zinc ion binding
palmitoyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9p22.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 31384.94
Theoretical pI 8.434
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|30425538|ref|NP_848661.1| palmitoyltransferase ZDHHC21 [Homo sapiens]
MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFC
LVALVRASIT
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IVQ6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20750
References
General References Not Available