| Identification |
| HMDB Protein ID
| HMDBP12021 |
| Secondary Accession Numbers
| None |
| Name
| Palmitoyltransferase ZDHHC21 |
| Synonyms
|
- Zinc finger DHHC domain-containing protein 21
- DHHC-21
|
| Gene Name
| ZDHHC21 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane. This affects rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect that mediated by their nuclear receptor (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
|
| Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A |
details
|
|
| GO Classification
|
| Biological Process |
| small molecule metabolic process |
| nitric oxide metabolic process |
| regulation of nitric-oxide synthase activity |
| hair follicle development |
| peptidyl-L-cysteine S-palmitoylation |
| sebaceous gland development |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| palmitoyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 9 |
| Locus
| 9p22.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 31384.94 |
| Theoretical pI
| 8.434 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|30425538|ref|NP_848661.1| palmitoyltransferase ZDHHC21 [Homo sapiens]
MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFC
LVALVRASIT
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IVQ6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20750 |
| References |
| General References
| Not Available |