| Identification |
| HMDB Protein ID
| HMDBP12009 |
| Secondary Accession Numbers
| None |
| Name
| Glycosaminoglycan xylosylkinase |
| Synonyms
|
- Protein FAM20B
- Xylose kinase
|
| Gene Name
| FAM20B |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Responsible for the 2-O-phosphorylation of xylose in the glycosaminoglycan-protein linkage region of proteoglycans thereby regulating the amount of mature GAG chains. Sulfated glycosaminoglycans (GAGs), including heparan sulfate and chondroitin sulfate, are synthesized on the so-called common GAG-protein linkage region (GlcUAbeta1-3Galbeta1-3Galbeta1-4Xylbeta1-O-Ser) of core proteins, which is formed by the stepwise addition of monosaccharide residues by the respective specific glycosyltransferases. Xylose 2-o-phosphorylation may influence the catalytic activity of B3GAT3 (GlcAT-I) which completes the precursor tetrasaccharide of GAG-protein linkage regions on which the repeating disaccharide region is synthesized.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + D-Xylose → ADP + D-xylose 2-phosphate |
details
|
|
| GO Classification
|
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Golgi apparatus |
| Molecular Function |
| ATP binding |
| phosphotransferase activity, alcohol group as acceptor |
| kinase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1q25 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 46432.04 |
| Theoretical pI
| 6.88 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|7662150|ref|NP_055679.1| glycosaminoglycan xylosylkinase [Homo sapiens]
MKLKQRVVLLAILLVIFIFTKVFLIDNLDTSAANREDQRAFHRMMTGLRVELAPKLDHTL
QSPWEIAAQW
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O75063 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:23017 |
| References |
| General References
| Not Available |