| Identification |
| HMDB Protein ID
| HMDBP12004 |
| Secondary Accession Numbers
| None |
| Name
| Vacuolar protein sorting-associated protein 29 |
| Synonyms
|
- hVPS29
- PEP11 homolog
- Vesicle protein sorting 29
|
| Gene Name
| VPS29 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Has low protein phosphatase activity towards a serine-phosphorylated peptide derived from IGF2R (in vitro).
|
| Pathways
|
Not Available
|
| Reactions
|
| O-phospho-L(or D)-serine + Water → L(or D)-serine + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| protein transport |
| Cellular Component |
| endosome |
| endosome membrane |
| Molecular Function |
| metal ion binding |
| phosphoserine phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 12 |
| Locus
| 12q24 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 20505.595 |
| Theoretical pI
| 6.791 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|7706441|ref|NP_057310.1| vacuolar protein sorting-associated protein 29 isoform 1 [Homo sapiens]
MLVLVLGDLHIPHRCNSLPAKFKKLLVPGKIQHILCTGNLCTKESYDYLKTLAGDVHIVR
GDFDENLNYP
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UBQ0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:14340 |
| References |
| General References
| Not Available |