| Identification |
| HMDB Protein ID
| HMDBP12001 |
| Secondary Accession Numbers
| None |
| Name
| Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 |
| Synonyms
|
- Diphosphoinositol pentakisphosphate kinase 2
- Histidine acid phosphatase domain-containing protein 1
- InsP6 and PP-IP5 kinase 2
- VIP1 homolog 2
- hsVIP2
|
| Gene Name
| PPIP5K2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Bifunctional inositol kinase that catalyzes the formation of diphosphoinositol pentakisphosphate (InsP7 or PP-InsP5) and bi-diphosphoinositol tetrakisphosphate (InsP8 or PP2-InsP4). Converts inositolitol hexakisphosphate (InsP6) to InsP7. Also able to convert InsP7 to InsP8. Probably specifically mediates the formation of 4PP-InsP5 and 6PP-InsP5 InsP7 isomers but not of 5PP-IP5 InsP7 isomer.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + 1D-myo-inositol hexakisphosphate → ADP + 1D-myo-inositol 5-diphosphate 1,2,3,4,6-pentakisphosphate |
details
|
| Adenosine triphosphate + 1D-myo-inositol 1,3,4,5,6-pentakisphosphate → ADP + 1D-myo-inositol diphosphate tetrakisphosphate (isomeric configuration unknown) |
details
|
| Adenosine triphosphate + 1D-myo-inositol 5-diphosphate pentakisphosphate → ADP + 1D-myo-inositol bisdiphosphate tetrakisphosphate (isomeric configuration unknown) |
details
|
| Adenosine triphosphate + 5-Diphosphoinositol pentakisphosphate → ADP + 1D-myo-Inositol bisdiphosphate tetrakisphosphate |
details
|
|
| GO Classification
|
| Biological Process |
| inositol metabolic process |
| Cellular Component |
| cytosol |
| Molecular Function |
| ATP binding |
| kinase activity |
| diphosphoinositol-pentakisphosphate kinase activity |
| inositol hexakisphosphate 1-kinase activity |
| inositol hexakisphosphate 3-kinase activity |
| inositol hexakisphosphate 5-kinase activity |
| inositol-1,3,4,5,6-pentakisphosphate kinase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 5 |
| Locus
| 5q21.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 138104.925 |
| Theoretical pI
| 8.056 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|41281583|ref|NP_056031.2| inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 isoform 2 [Homo sapiens]
MSEAPRFFVGPEDTEINPGNYRHFFHHADEDDEEEDDSPPERQIVVGICSMAKKSKSKPM
KEILERISLF
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| O43314 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:29035 |
| References |
| General References
| Not Available |