Hmdb loader
Identification
HMDB Protein ID HMDBP11999
Secondary Accession Numbers None
Name Vesicular acetylcholine transporter
Synonyms
  1. VAChT
  2. Solute carrier family 18 member 3
Gene Name SLC18A3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Involved in acetylcholine transport into synaptic vesicles.
Pathways
  • Cholinergic synapse
  • Synaptic vesicle cycle
Reactions Not Available
GO Classification
Biological Process
neurotransmitter secretion
acetylcholine transport
Cellular Component
axon terminus
integral to plasma membrane
synaptic vesicle
AP-1 adaptor complex
AP-2 adaptor complex
clathrin-sculpted acetylcholine transport vesicle membrane
Molecular Function
acetylcholine binding
acetylcholine transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10q11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 56902.595
Theoretical pI 6.191
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|118582257|ref|NP_003046.2| vesicular acetylcholine transporter [Homo sapiens]
MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGGEG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q16572
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:10936
References
General References Not Available