| Identification |
| HMDB Protein ID
| HMDBP11999 |
| Secondary Accession Numbers
| None |
| Name
| Vesicular acetylcholine transporter |
| Synonyms
|
- VAChT
- Solute carrier family 18 member 3
|
| Gene Name
| SLC18A3 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Involved in acetylcholine transport into synaptic vesicles.
|
| Pathways
|
- Cholinergic synapse
- Synaptic vesicle cycle
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| neurotransmitter secretion |
| acetylcholine transport |
| Cellular Component |
| axon terminus |
| integral to plasma membrane |
| synaptic vesicle |
| AP-1 adaptor complex |
| AP-2 adaptor complex |
| clathrin-sculpted acetylcholine transport vesicle membrane |
| Molecular Function |
| acetylcholine binding |
| acetylcholine transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 10 |
| Locus
| 10q11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 56902.595 |
| Theoretical pI
| 6.191 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|118582257|ref|NP_003046.2| vesicular acetylcholine transporter [Homo sapiens]
MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGGEG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q16572 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:10936 |
| References |
| General References
| Not Available |