| Identification |
| HMDB Protein ID
| HMDBP11994 |
| Secondary Accession Numbers
| None |
| Name
| Ubiquitin-conjugating enzyme E2 T |
| Synonyms
|
- Cell proliferation-inducing gene 50 protein
- Ubiquitin carrier protein T
- Ubiquitin-protein ligase T
|
| Gene Name
| UBE2T |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes monoubiquitination. Involved in mitomycin-C (MMC)-induced DNA repair: acts as a specific E2 ubiquitin-conjugating enzyme for the Fanconi anemia complex by associating with E3 ubiquitin-protein ligase FANCL and catalyzing monoubiquitination of FANCD2, a key step in the DNA damage pathway. Also mediates monoubiquitination of FANCL and FANCI. May contribute to ubiquitination and degradation of BRCA1. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11'-, 'Lys-27'-, 'Lys-48'- and 'Lys-63'-linked polyubiquitination.
|
| Pathways
|
- Fanconi anemia pathway
- protein ubiquitination
|
| Reactions
|
| Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine |
details
|
|
| GO Classification
|
| Biological Process |
| DNA repair |
| protein K48-linked ubiquitination |
| protein K11-linked ubiquitination |
| protein monoubiquitination |
| protein K27-linked ubiquitination |
| protein K29-linked ubiquitination |
| protein K6-linked ubiquitination |
| protein K63-linked ubiquitination |
| protein autoubiquitination |
| Cellular Component |
| nucleoplasm |
| Molecular Function |
| ATP binding |
| chromatin binding |
| ubiquitin-protein ligase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1q32.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 22520.65 |
| Theoretical pI
| 7.991 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|7661808|ref|NP_054895.1| ubiquitin-conjugating enzyme E2 T [Homo sapiens]
MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPER
YPFEPPQIRF
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NPD8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25009 |
| References |
| General References
| Not Available |