| Identification |
|---|
| HMDB Protein ID
| HMDBP11986 |
| Secondary Accession Numbers
| None |
| Name
| Ubiquitin-conjugating enzyme E2Q-like protein 1 |
| Synonyms
|
Not Available
|
| Gene Name
| UBE2QL1 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Catalyzes the covalent attachment of ubiquitin to other proteins (Potential).
|
| Pathways
|
- protein ubiquitination
- Ubiquitin mediated proteolysis
|
| Reactions
|
| Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine |
details
|
|
| GO Classification
|
| Molecular Function |
| ATP binding |
| ubiquitin-protein ligase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 5 |
| Locus
| 5p15.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 18337.93 |
| Theoretical pI
| 7.961 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|223555979|ref|NP_001138633.1| ubiquitin-conjugating enzyme E2Q-like protein 1 [Homo sapiens]
MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPD
NFPFSPPFMR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| A1L167 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:37269 |
| References |
|---|
| General References
| Not Available |
