| Identification |
|---|
| HMDB Protein ID
| HMDBP11968 |
| Secondary Accession Numbers
| None |
| Name
| Sugar transporter SWEET1 |
| Synonyms
|
- HsSWEET1
- RAG1-activating protein 1
- Solute carrier family 50 member 1
- Stromal cell protein
|
| Gene Name
| SLC50A1 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1.
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| DNA recombination |
| carbohydrate transport |
| positive regulation of gene expression, epigenetic |
| Cellular Component |
| integral to membrane |
| plasma membrane |
| nucleus |
| endomembrane system |
| Golgi membrane |
| Golgi apparatus |
| Molecular Function |
| glucoside transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 1 |
| Locus
| 1q22 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 19050.135 |
| Theoretical pI
| 9.247 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|170932479|ref|NP_001116309.1| sugar transporter SWEET1 isoform b [Homo sapiens]
MRGLHPWHVLRRPLGPQAHANDPECGQRPVPALSHHGSQRVVLLQTATLLGVLLLGYGYF
WLLVPNPEAR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BRV3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:30657 |
| References |
|---|
| General References
| Not Available |
