Hmdb loader
Identification
HMDB Protein ID HMDBP11967
Secondary Accession Numbers None
Name Speckle targeted PIP5K1A-regulated poly(A) polymerase
Synonyms
  1. Star-PAP
  2. RNA-binding motif protein 21
  3. U6 snRNA-specific terminal uridylyltransferase 1
  4. RNA-binding protein 21
  5. U6-TUTase
Gene Name TUT1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Poly(A) polymerase that creates the 3'-poly(A) tail of specific pre-mRNAs. Localizes to nuclear speckles together with PIP5K1A and mediates polyadenylation of a select set of mRNAs, such as HMOX1. In addition to polyadenylation, it is also required for the 3'-end cleavage of pre-mRNAs: binds to the 3'UTR of targeted pre-mRNAs and promotes the recruitment and assembly of the CPSF complex on the 3'UTR of pre-mRNAs. In addition to adenylyltransferase activity, also has uridylyltransferase activity. However, the ATP ratio is higher than UTP in cells, suggesting that it functions primarily as a poly(A) polymerase. Acts as a specific terminal uridylyltransferase for U6 snRNA in vitro: responsible for a controlled elongation reaction that results in the restoration of the four 3'-terminal UMP-residues found in newly transcribed U6 snRNA. Not involved in replication-dependent histone mRNA degradation.
Pathways Not Available
Reactions
Uridine triphosphate + RNA(n) → Pyrophosphate + RNA(n+1) details
Adenosine triphosphate + RNA(n) → Pyrophosphate + RNA(n+1) details
GO Classification
Biological Process
mRNA polyadenylation
mRNA cleavage
snRNA processing
Cellular Component
nucleolus
nuclear speck
Molecular Function
metal ion binding
ATP binding
zinc ion binding
mRNA 3'-UTR binding
polynucleotide adenylyltransferase activity
RNA uridylyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11q12.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 98434.355
Theoretical pI 6.436
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|226371750|ref|NP_073741.2| speckle targeted PIP5K1A-regulated poly(A) polymerase [Homo sapiens]
MSLPIGSAEVASERVELWRSGFRWWQRCLCFCRYRRVAMAAVDSDVESLPRGGFRCCLCH
VTTANRPSLD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H6E5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26184
References
General References Not Available