| Identification |
| HMDB Protein ID
| HMDBP11965 |
| Secondary Accession Numbers
| None |
| Name
| Sulfotransferase 1C3 |
| Synonyms
|
- ST1C3
|
| Gene Name
| SULT1C3 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor and has low sulphotransferase activity towards various substrates with alcohol groups (in vitro). May catalyze the sulfate conjugation of xenobiotic compounds and endogenous substrates.
|
| Pathways
|
Not Available
|
| Reactions
|
| Phosphoadenosine phosphosulfate + an alcohol → Adenosine 3',5'-diphosphate + an alkyl sulfate |
details
|
|
| GO Classification
|
| Biological Process |
| sulfur compound metabolic process |
| Cellular Component |
| cytoplasm |
| Molecular Function |
| aryl sulfotransferase activity |
| alcohol sulfotransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 2 |
| Locus
| 2q12.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 35888.345 |
| Theoretical pI
| 6.911 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|56847626|ref|NP_001008743.1| sulfotransferase 1C3 [Homo sapiens]
MAKIEKNAPTMEKKPELFNIMEVDGVPTLILSKEWWEKVCNFQAKPDDLILATYPKSGTT
WMHEILDMIL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q6IMI6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:33543 |
| References |
| General References
| Not Available |