| Identification |
| HMDB Protein ID
| HMDBP11958 |
| Secondary Accession Numbers
| None |
| Name
| Superkiller viralicidic activity 2-like 2 |
| Synonyms
|
- ATP-dependent helicase SKIV2L2
|
| Gene Name
| SKIV2L2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| May be involved in pre-mRNA splicing. Associated with the RNA exosome complex and involved in the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA.
|
| Pathways
|
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| mRNA splicing, via spliceosome |
| maturation of 5.8S rRNA |
| Cellular Component |
| nucleolus |
| catalytic step 2 spliceosome |
| Molecular Function |
| ATP binding |
| nucleic acid binding |
| ATP-dependent helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 5 |
| Locus
| 5q11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 117803.765 |
| Theoretical pI
| 6.529 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|193211480|ref|NP_056175.3| superkiller viralicidic activity 2-like 2 [Homo sapiens]
MADAFGDELFSVFEGDSTTAAGTKKDKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNG
KNKRDVDFEG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P42285 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18734 |
| References |
| General References
| Not Available |