| Identification |
| HMDB Protein ID
| HMDBP11956 |
| Secondary Accession Numbers
| None |
| Name
| Beta-galactoside alpha-2,6-sialyltransferase 1 |
| Synonyms
|
- Alpha 2,6-ST 1
- B-cell antigen CD75
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1
- ST6Gal I
- Sialyltransferase 1
- ST6GalI
|
| Gene Name
| ST6GAL1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates.
|
| Pathways
|
- N-Glycan biosynthesis
- Other types of O-glycan biosynthesis
- protein glycosylation
|
| Reactions
|
| Cytidine 5'-monophosphate-N-acetylneuraminic acid + beta-D-galactosyl-1,4-N-acetyl-beta-D-glucosamine → Cytidine monophosphate + (N-acetylneuraminosyl(a2-6)lactosamine) |
details
|
| CMP-N-acetylneuraminate + → CMP + DS 3 |
details
|
| CMP-N-acetylneuraminate + → CMP + |
details
|
|
| GO Classification
|
| Biological Process |
| post-translational protein modification |
| protein N-linked glycosylation via asparagine |
| O-glycan processing |
| humoral immune response |
| Cellular Component |
| integral to Golgi membrane |
| Golgi membrane |
| extracellular region |
| Golgi cisterna membrane |
| Molecular Function |
| sialyltransferase activity |
| beta-galactoside alpha-2,6-sialyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 3 |
| Locus
| 3q27-q28 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 46604.235 |
| Theoretical pI
| 9.006 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|4506949|ref|NP_003023.1| beta-galactoside alpha-2,6-sialyltransferase 1 isoform a [Homo sapiens]
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDS
QSVSSSSTQD
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P15907 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:10860 |
| References |
| General References
| Not Available |