Hmdb loader
Identification
HMDB Protein ID HMDBP11947
Secondary Accession Numbers None
Name Solute carrier family 52, riboflavin transporter, member 2
Synonyms
  1. Porcine endogenous retrovirus A receptor 1
  2. Protein GPR172A
  3. Riboflavin transporter 3
  4. PERV-A receptor 1
  5. hRFT3
Gene Name SLC52A2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Riboflavin transporter. Riboflavin transport is Na(+)-independent but moderately pH-sensitive. Activity is strongly inhibited by riboflavin analogs, such as lumiflavin. Weakly inhibited by flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN). In case of infection by retroviruses, acts as a cell receptor to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A).
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
integral to plasma membrane
Molecular Function
riboflavin transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus 8q24.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 45776.61
Theoretical pI 7.146
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|359465547|ref|NP_001240744.1| solute carrier family 52, riboflavin transporter, member 2 [Homo sapiens]
MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNL
GLLVVTLWRR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9HAB3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:30224
References
General References Not Available