| Identification |
| HMDB Protein ID
| HMDBP11947 |
| Secondary Accession Numbers
| None |
| Name
| Solute carrier family 52, riboflavin transporter, member 2 |
| Synonyms
|
- Porcine endogenous retrovirus A receptor 1
- Protein GPR172A
- Riboflavin transporter 3
- PERV-A receptor 1
- hRFT3
|
| Gene Name
| SLC52A2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Riboflavin transporter. Riboflavin transport is Na(+)-independent but moderately pH-sensitive. Activity is strongly inhibited by riboflavin analogs, such as lumiflavin. Weakly inhibited by flavin adenine dinucleotide (FAD) and flavin mononucleotide (FMN). In case of infection by retroviruses, acts as a cell receptor to retroviral envelopes similar to the porcine endogenous retrovirus (PERV-A).
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Cellular Component |
| integral to plasma membrane |
| Molecular Function |
| riboflavin transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 8 |
| Locus
| 8q24.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 45776.61 |
| Theoretical pI
| 7.146 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|359465547|ref|NP_001240744.1| solute carrier family 52, riboflavin transporter, member 2 [Homo sapiens]
MAAPTPARPVLTHLLVALFGMGSWAAVNGIWVELPVVVKELPEGWSLPSYVSVLVALGNL
GLLVVTLWRR
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9HAB3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:30224 |
| References |
| General References
| Not Available |