| Identification |
| HMDB Protein ID
| HMDBP11946 |
| Secondary Accession Numbers
| None |
| Name
| Zinc transporter ZIP13 |
| Synonyms
|
- LIV-1 subfamily of ZIP zinc transporter 9
- Solute carrier family 39 member 13
- Zrt- and Irt-like protein 13
- LZT-Hs9
- ZIP-13
|
| Gene Name
| SLC39A13 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Acts as a zinc-influx transporter.
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| cellular zinc ion homeostasis |
| connective tissue development |
| Cellular Component |
| integral to Golgi membrane |
| perinuclear region of cytoplasm |
| Molecular Function |
| zinc ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 11 |
| Locus
| 11p11.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 38938.04 |
| Theoretical pI
| 5.443 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|190014617|ref|NP_001121697.1| zinc transporter ZIP13 isoform a precursor [Homo sapiens]
MPGCPCPGCGMAGPRLLFLTALALELLGRAGGSQPALRSRGTATACRLDNKESESWGALL
SGERLDTWIC
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96H72 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20859 |
| References |
| General References
| Not Available |