Hmdb loader
Identification
HMDB Protein ID HMDBP11945
Secondary Accession Numbers None
Name Zinc transporter ZIP12
Synonyms
  1. LIV-1 subfamily of ZIP zinc transporter 8
  2. Solute carrier family 39 member 12
  3. Zrt- and Irt-like protein 12
  4. LZT-Hs8
  5. ZIP-12
Gene Name SLC39A12
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Acts as a zinc-influx transporter (Potential). May be partly involved in the outbreak of schizophrenia.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
zinc ion transport
Cellular Component
integral to membrane
Molecular Function
metal ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10p12.33
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 76665.43
Theoretical pI 6.287
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|223633939|ref|NP_001138667.1| zinc transporter ZIP12 isoform 1 precursor [Homo sapiens]
MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNH
SRSLIKTLLE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q504Y0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20860
References
General References Not Available