| Identification |
| HMDB Protein ID
| HMDBP11942 |
| Secondary Accession Numbers
| None |
| Name
| Zinc transporter ZIP9 |
| Synonyms
|
- Solute carrier family 39 member 9
- Zrt- and Irt-like protein 9
- ZIP-9
|
| Gene Name
| SLC39A9 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| May act as a zinc-influx transporter (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| zinc ion transport |
| Cellular Component |
| integral to membrane |
| Molecular Function |
| metal ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 14 |
| Locus
| 14q24.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 29930.595 |
| Theoretical pI
| 6.678 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|356460995|ref|NP_001239077.1| zinc transporter ZIP9 isoform 2 [Homo sapiens]
MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVH
ALYEDILEGK
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NUM3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20182 |
| References |
| General References
| Not Available |