| Identification |
| HMDB Protein ID
| HMDBP11933 |
| Secondary Accession Numbers
| None |
| Name
| UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter |
| Synonyms
|
- Homolog of Fringe connection protein 1
- SQV7-like protein
- Solute carrier family 35 member D2
- UDP-galactose transporter-related protein 8
- HFRC1
- SQV7L
- UGTrel8
|
| Gene Name
| SLC35D2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Antiporter transporting nucleotide sugars such as UDP-N-acetylglucosamine (UDP-GlcNAc), UDP-glucose (UDP-Glc) and GDP-mannose (GDP-Man) pooled in the cytosol into the lumen of the Golgi in exchange for the corresponding nucleosides monophosphates (UMP for UDP-sugars and GMP for GDP-sugars). May take part in heparan sulfate synthesis by supplying UDP-Glc-NAc, the donor substrate, and thus be involved in growth factor signaling.
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| carbohydrate transport |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| nucleotide-sugar transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 9 |
| Locus
| 9q22.32 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 36672.12 |
| Theoretical pI
| 8.689 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|223029426|ref|NP_008932.2| UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter [Homo sapiens]
MTAGGQAEAEGAGGEPGAARLPSRVARLLSALFYGTCSFLIVLVNKALLTTYGFPSPIFL
GIGQMAATIM
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q76EJ3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20799 |
| References |
| General References
| Not Available |