Hmdb loader
Identification
HMDB Protein ID HMDBP11931
Secondary Accession Numbers None
Name Sulfate anion transporter 1
Synonyms
  1. SAT-1
  2. Solute carrier family 26 member 1
Gene Name SLC26A1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function High affinity uptake of sulfate. Accepts oxalate, but not succinate as a cosubstrate.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
sulfate transport
Cellular Component
integral to membrane
plasma membrane
Molecular Function
secondary active sulfate transmembrane transporter activity
chloride transmembrane transporter activity
oxalate transmembrane transporter activity
sulfate transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4p16.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 75014.72
Theoretical pI 8.104
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|20336272|ref|NP_071325.2| sulfate anion transporter 1 isoform a [Homo sapiens]
MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWL
RQYRPREYLA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H2B4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:10993
References
General References Not Available