| Identification |
| HMDB Protein ID
| HMDBP11917 |
| Secondary Accession Numbers
| None |
| Name
| Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 |
| Synonyms
|
- RNA polymerase II-associated protein 2
|
| Gene Name
| RPAP2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Protein phosphatase that displays CTD phosphatase activity and regulates transcription of snRNA genes. Recognizes and binds phosphorylated 'Ser-7' of the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and mediates dephosphorylation of 'Ser-5' of the CTD, thereby promoting transcription of snRNA genes.
|
| Pathways
|
Not Available
|
| Reactions
|
| A phosphoprotein + Water → a protein + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| dephosphorylation of RNA polymerase II C-terminal domain |
| snRNA transcription |
| Cellular Component |
| cytoplasm |
| DNA-directed RNA polymerase II, holoenzyme |
| Molecular Function |
| metal ion binding |
| CTD phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p22.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 69508.135 |
| Theoretical pI
| 7.788 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|226246608|ref|NP_079089.2| putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 [Homo sapiens]
MADFAGPSSAGRKAGAPRCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALH
IVEQLLEENI
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IXW5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25791 |
| References |
| General References
| Not Available |