Hmdb loader
Identification
HMDB Protein ID HMDBP11914
Secondary Accession Numbers None
Name DNA-directed RNA polymerases I, II, and III subunit RPABC4
Synonyms
  1. RNA polymerases I, II, and III subunit ABC4
  2. ABC10-alpha
  3. DNA-directed RNA polymerase II subunit K
  4. RNA polymerase II 7.0 kDa subunit
  5. RPB10alpha
  6. RPB7.0
Gene Name POLR2K
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively.
Pathways
  • Cytosolic DNA-sensing pathway
  • Epstein-Barr virus infection
  • Huntington disease
  • Purine metabolism
  • Pyrimidine metabolism
  • RNA polymerase
Reactions
Adenosine triphosphate + RNA → Pyrophosphate + RNA details
Guanosine triphosphate + RNA → Pyrophosphate + RNA details
Cytidine triphosphate + RNA → Pyrophosphate + RNA details
Uridine triphosphate + RNA → Pyrophosphate + RNA details
GO Classification
Biological Process
mRNA splicing, via spliceosome
regulation of transcription from RNA polymerase I promoter
transcription elongation from RNA polymerase III promoter
termination of RNA polymerase III transcription
transcription initiation from RNA polymerase I promoter
transcription elongation from RNA polymerase I promoter
termination of RNA polymerase I transcription
7-methylguanosine mRNA capping
transcription-coupled nucleotide-excision repair
transcription elongation from RNA polymerase II promoter
positive regulation of viral transcription
transcription initiation from RNA polymerase II promoter
viral reproduction
Cellular Component
nucleoplasm
Molecular Function
metal ion binding
DNA-directed RNA polymerase activity
DNA binding
zinc ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus 8q22.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 7004.145
Theoretical pI 9.063
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|4826924|ref|NP_005025.1| DNA-directed RNA polymerases I, II, and III subunit RPABC4 [Homo sapiens]
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P53803
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9198
References
General References Not Available