| Identification |
| HMDB Protein ID
| HMDBP11906 |
| Secondary Accession Numbers
| None |
| Name
| Epidermal retinol dehydrogenase 2 |
| Synonyms
|
- EPHD-2
- RDH-E2
- Retinal short-chain dehydrogenase reductase 2
- Short-chain dehydrogenase/reductase family 16C member 5
- retSDR2
|
| Gene Name
| SDR16C5 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Oxidoreductase with strong preference for NAD. Active in both the oxidative and reductive directions. Oxidizes all-trans-retinol in all-trans-retinaldehyde. No activity was detected with 11-cis-retinol or 11-cis-retinaldehyde as substrates with either NAD(+)/NADH or NADP(+)/NADPH.
|
| Pathways
|
|
| Reactions
|
| All-trans-retinol-[cellular-retinol-binding-protein] + NAD → all-trans-retinal-[cellular-retinol-binding-protein] + NADH |
details
|
| Vitamin A + NAD → Retinal + NADH + Hydrogen Ion |
details
|
|
| GO Classification
|
| Biological Process |
| retinol metabolic process |
| retinal metabolic process |
| detection of light stimulus involved in visual perception |
| keratinocyte proliferation |
| Cellular Component |
| integral to membrane |
| endoplasmic reticulum membrane |
| Molecular Function |
| nucleotide binding |
| retinol dehydrogenase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 8 |
| Locus
| 8q12.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 34095.0 |
| Theoretical pI
| 8.454 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|40807363|ref|NP_620419.2| epidermal retinol dehydrogenase 2 [Homo sapiens]
MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQF
ARLGSVLVLW
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8N3Y7 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:30311 |
| References |
| General References
| Not Available |