| Identification |
| HMDB Protein ID
| HMDBP11905 |
| Secondary Accession Numbers
| None |
| Name
| Glutaminyl-peptide cyclotransferase-like protein |
| Synonyms
|
- Golgi-resident glutaminyl-peptide cyclotransferase
- isoQC
- gQC
|
| Gene Name
| QPCTL |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Responsible for the biosynthesis of pyroglutamyl peptides.
|
| Pathways
|
Not Available
|
| Reactions
|
| L-glutaminyl-peptide → 5-oxoprolyl-peptide + Ammonia |
details
|
|
| GO Classification
|
| Biological Process |
| proteolysis |
| peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Golgi apparatus |
| Molecular Function |
| metal ion binding |
| zinc ion binding |
| peptidase activity |
| glutaminyl-peptide cyclotransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 19 |
| Locus
| 19q13.32 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 32911.255 |
| Theoretical pI
| 10.745 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|254281335|ref|NP_001156849.1| glutaminyl-peptide cyclotransferase-like protein isoform 2 [Homo sapiens]
MRSGGRGRPRLRLGERGLMEPLLPPKRRLLPRVRLLPLLLALAVGSAFYTIWSGWHRRTE
ELPLGRELRV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NXS2 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25952 |
| References |
| General References
| Not Available |