| Identification |
| HMDB Protein ID
| HMDBP11901 |
| Secondary Accession Numbers
| None |
| Name
| Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 |
| Synonyms
|
- ATP-dependent RNA helicase DHX38
- DEAH box protein 38
|
| Gene Name
| DHX38 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Probable ATP-binding RNA helicase involved in pre-mRNA splicing.
|
| Pathways
|
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| mRNA export from nucleus |
| mRNA splicing, via spliceosome |
| termination of RNA polymerase II transcription |
| mRNA 3'-end processing |
| Cellular Component |
| nucleoplasm |
| catalytic step 2 spliceosome |
| Molecular Function |
| ATP binding |
| nucleic acid binding |
| ATP-dependent helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 16 |
| Locus
| 16q22 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 140501.58 |
| Theoretical pI
| 6.538 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|17999539|ref|NP_054722.2| pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 [Homo sapiens]
MGDTSEDASIHRLEGTDLDCQVGGLICKSKSAASEQHVFKAPAPRPSLLGLDLLASLKRR
EREEKDDGED
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q92620 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17211 |
| References |
| General References
| Not Available |