| Identification |
| HMDB Protein ID
| HMDBP11876 |
| Secondary Accession Numbers
| None |
| Name
| Twinkle protein, mitochondrial |
| Synonyms
|
- Progressive external ophthalmoplegia 1 protein
- T7 gp4-like protein with intramitochondrial nucleoid localization
- T7-like mitochondrial DNA helicase
|
| Gene Name
| PEO1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Involved in mitochondrial DNA (mtDNA) metabolism. Could function as an adenine nucleotide-dependent DNA helicase. Function inferred to be critical for lifetime maintenance of mtDNA integrity. In vitro, forms in combination with POLG, a processive replication machinery, which can use double-stranded DNA (dsDNA) as template to synthesize single-stranded DNA (ssDNA) molecules. May be a key regulator of mtDNA copy number in mammals.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| cell death |
| protein homooligomerization |
| mitochondrial DNA replication |
| DNA unwinding involved in replication |
| protein hexamerization |
| transcription from mitochondrial promoter |
| Cellular Component |
| mitochondrial nucleoid |
| Molecular Function |
| ATP binding |
| single-stranded DNA binding |
| 5'-3' DNA helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 10 |
| Locus
| 10q24 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 66014.925 |
| Theoretical pI
| 8.113 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|255304946|ref|NP_001157284.1| twinkle protein, mitochondrial isoform B [Homo sapiens]
MWVLLRSGYPLRILLPLRGEWMGRRGLPRNLAPGPPRRRYRKETLQALDMPVLPVTATEI
RQYLRGHGIP
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96RR1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:1160 |
| References |
| General References
| Not Available |