| Identification |
|---|
| HMDB Protein ID
| HMDBP11875 |
| Secondary Accession Numbers
| None |
| Name
| Poly(A) polymerase beta |
| Synonyms
|
- PAP-beta
- Polynucleotide adenylyltransferase beta
- Testis-specific poly(A) polymerase
|
| Gene Name
| PAPOLB |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Not Available |
| Pathways
|
- mRNA surveillance pathway
|
| Reactions
|
| Adenosine triphosphate + RNA(n) → Pyrophosphate + RNA(n+1) |
details
|
|
| GO Classification
|
| Biological Process |
| mRNA splicing, via spliceosome |
| mRNA polyadenylation |
| termination of RNA polymerase II transcription |
| Cellular Component |
| cytoplasm |
| endoplasmic reticulum |
| nucleus |
| Molecular Function |
| metal ion binding |
| ATP binding |
| RNA binding |
| polynucleotide adenylyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 7 |
| Locus
| 7p22.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 71811.97 |
| Theoretical pI
| 6.449 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|77874206|ref|NP_064529.4| poly(A) polymerase beta [Homo sapiens]
MMPFPVTTQGPPQPAPPPNRYGVSSPISLAVPKETDCLLTQRLIETLRPFGVFEEEEELQ
RRILVLEKLN
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NRJ5 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:15970 |
| References |
|---|
| General References
| Not Available |
