Hmdb loader
Identification
HMDB Protein ID HMDBP11873
Secondary Accession Numbers None
Name DNA polymerase sigma
Synonyms
  1. DNA polymerase kappa
  2. LAK-1
  3. PAP-associated domain-containing protein 7
  4. Terminal uridylyltransferase 5
  5. Topoisomerase-related function protein 4-1
  6. TUTase 5
  7. TRF4-1
Gene Name PAPD7
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA polymerase, probably involved in DNA repair. May play a role in sister chromatid cohesion. Does not play a role in replication-dependent histone mRNA degradation.
Pathways
  • Nucleotide Excision Repair
  • RNA degradation
Reactions
Deoxynucleoside triphosphate + DNA(n) → Pyrophosphate + DNA(n+1) details
GO Classification
Biological Process
response to drug
DNA replication
cell division
sister chromatid cohesion
double-strand break repair
mitotic chromosome condensation
Cellular Component
nucleus
Molecular Function
metal ion binding
DNA binding
DNA-directed DNA polymerase activity
SMC family protein binding
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5p15
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 59745.09
Theoretical pI 9.39
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|284507293|ref|NP_001165276.1| DNA polymerase sigma isoform 2 [Homo sapiens]
MSPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPP
LQLLEQALRK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q5XG87
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:16705
References
General References Not Available