| Identification |
| HMDB Protein ID
| HMDBP11867 |
| Secondary Accession Numbers
| None |
| Name
| Sodium-dependent phosphate transport protein 2A |
| Synonyms
|
- Sodium-phosphate transport protein 2A
- Na(+)-dependent phosphate cotransporter 2A
- NaPi-3
- Sodium/phosphate cotransporter 2A
- Solute carrier family 34 member 1
- Na(+)/Pi cotransporter 2A
- NaPi-2a
|
| Gene Name
| SLC34A1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane. Probably mediates 70-80% of the apical influx.
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| response to cadmium ion |
| response to mercury ion |
| response to lead ion |
| bone remodeling |
| response to magnesium ion |
| sodium ion transport |
| phosphate ion homeostasis |
| Cellular Component |
| integral to plasma membrane |
| basolateral plasma membrane |
| brush border membrane |
| Molecular Function |
| symporter activity |
| sodium-dependent phosphate transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 5 |
| Locus
| 5q35 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 36602.125 |
| Theoretical pI
| 6.651 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|262399385|ref|NP_001161051.1| sodium-dependent phosphate transport protein 2A isoform 2 [Homo sapiens]
MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEH
TCPCGEVLER
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q06495 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:11019 |
| References |
| General References
| Not Available |