| Identification |
| HMDB Protein ID
| HMDBP11861 |
| Secondary Accession Numbers
| None |
| Name
| Magnesium transporter NIPA4 |
| Synonyms
|
- Ichthyin
- NIPA-like protein 4
- Non-imprinted in Prader-Willi/Angelman syndrome region protein 4
|
| Gene Name
| NIPAL4 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Ba(2+), Mn(2+), Sr(2+) and Co(2+) but to a much less extent than Mg(2+) (By similarity). May be a receptor for ligands (trioxilins A3 and B3) from the hepoxilin pathway.
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Cellular Component |
| integral to membrane |
| Molecular Function |
| magnesium ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 5 |
| Locus
| 5q33.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 50057.055 |
| Theoretical pI
| 7.425 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|149944536|ref|NP_001092757.1| magnesium transporter NIPA4 isoform 1 [Homo sapiens]
MPGDSSPGTLPLWDASLSPPLGPDPGGFSRASHAGDKSRPPAPELGSPGAVRPRVGSCAP
GPMELRVSNT
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q0D2K0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28018 |
| References |
| General References
| Not Available |