Hmdb loader
Identification
HMDB Protein ID HMDBP11851
Secondary Accession Numbers None
Name Bifunctional protein NCOAT
Synonyms
  1. Meningioma-expressed antigen 5
  2. Nuclear cytoplasmic O-GlcNAcase and acetyltransferase
Gene Name MGEA5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Cleaves GlcNAc but not GalNAc from glycopeptides. Can use p-nitrophenyl-beta-GlcNAc as substrate but not p-nitrophenyl-beta-GalNAc or p-nitrophenyl-alpha-GlcNAc. Possesses hyaluronidase activity. Acetylates 'Lys-8' of histone H4 and 'Lys-14' of histone H3 (By similarity).
Pathways Not Available
Reactions
[Protein]-3-O-(N-acetyl-D-glucosaminyl)-L-serine + Water → [protein]-L-serine + N-Acetyl-D-glucosamine details
[Protein]-3-O-(N-acetyl-D-glucosaminyl)-L-threonine + Water → [protein]-L-threonine + N-Acetyl-D-glucosamine details
Acetyl-CoA + [histone] → Coenzyme A + acetyl-[histone] details
[Protein]-3-O-(N-acetyl-D-glucosaminyl)-L-serine + Water → [Protein]-L-serine + N-Acetyl-D-glucosamine details
[Protein]-3-O-(N-acetyl-D-glucosaminyl)-L-threonine + Water → [Protein]-L-threonine + N-Acetyl-D-glucosamine details
GO Classification
Biological Process
positive regulation of cell killing
positive regulation of protein complex disassembly
positive regulation of growth hormone secretion
positive regulation of glucose import
positive regulation of DNA metabolic process
negative regulation of protein glycosylation
negative regulation of cardiac muscle adaptation
necrotic cell death
glycoprotein catabolic process
dATP metabolic process
positive regulation of mitochondrial depolarization
protein targeting to membrane
positive regulation of proteolysis
N-acetylglucosamine metabolic process
response to steroid hormone stimulus
positive regulation of calcium ion transport into cytosol
aging
positive regulation of insulin secretion
Cellular Component
cytoplasm
nucleus
Molecular Function
hyalurononglucosaminidase activity
histone acetyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10q24.1-q24.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 96930.75
Theoretical pI 5.025
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|215490056|ref|NP_001135906.1| bifunctional protein NCOAT isoform b [Homo sapiens]
MVQKESQATLEERESELSSNPAASAGASLEPPAAPAPGEDNPAGAGGAAVAGAAGGARRF
LCGVVEGFYG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O60502
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:7056
References
General References Not Available