| Identification |
| HMDB Protein ID
| HMDBP11850 |
| Secondary Accession Numbers
| None |
| Name
| Neuron navigator 2 |
| Synonyms
|
- Helicase APC down-regulated 1
- Pore membrane and/or filament-interacting-like protein 2
- Retinoic acid inducible in neuroblastoma 1
- Steerin-2
- Unc-53 homolog 2
- unc53H2
|
| Gene Name
| NAV2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Possesses 3' to 5' helicase activity and exonuclease activity. Involved in neuronal development, specifically in the development of different sensory organs.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| sensory perception of smell |
| locomotory behavior |
| sensory perception of sound |
| glossopharyngeal nerve development |
| optic nerve development |
| regulation of systemic arterial blood pressure by baroreceptor feedback |
| vagus nerve development |
| Cellular Component |
| nucleus |
| interstitial matrix |
| Molecular Function |
| ATP binding |
| heparin binding |
| helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 11 |
| Locus
| 11p15.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 254975.72 |
| Theoretical pI
| 8.945 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|161169015|ref|NP_001104488.1| neuron navigator 2 isoform 3 [Homo sapiens]
MESVSESSQQQKRKPVIHGLEDQKRIYTDWANHYLAKSGHKRLIRDLQQDVTDGVLLAQI
IQVVANEKIE
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IVL1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:15997 |
| References |
| General References
| Not Available |