| Identification |
| HMDB Protein ID
| HMDBP11847 |
| Secondary Accession Numbers
| None |
| Name
| N-alpha-acetyltransferase 60 |
| Synonyms
|
- Histone acetyltransferase type B protein 4
- N-acetyltransferase 15
- NatF catalytic subunit
- HAT4
|
| Gene Name
| NAA60 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Histone acetyltransferase localized in the Golgi apparatus that mediates acetylation of free histone H4, thereby facilitating nucleosome assembly. Has a preference for free histone H4 'Lys-20'(H4K20ac), 'Lys-79'(H4K79ac) and 'Lys-91' (H4K91ac). Also displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase.
|
| Pathways
|
Not Available
|
| Reactions
|
| Acetyl-CoA + peptide → N(alpha)-acetylpeptide + Coenzyme A |
details
|
| Acetyl-CoA + [histone] → Coenzyme A + acetyl-[histone] |
details
|
|
| GO Classification
|
| Biological Process |
| cell proliferation |
| chromosome segregation |
| nucleosome assembly |
| N-terminal peptidyl-methionine acetylation |
| Cellular Component |
| Golgi membrane |
| Molecular Function |
| peptide alpha-N-acetyltransferase activity |
| H4 histone acetyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 16 |
| Locus
| 16p13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 27451.075 |
| Theoretical pI
| 7.604 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|134254440|ref|NP_001077069.1| N-alpha-acetyltransferase 60 [Homo sapiens]
MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYR
GAIVGMIVAE
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H7X0 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25875 |
| References |
| General References
| Not Available |