| Identification |
| HMDB Protein ID
| HMDBP11844 |
| Secondary Accession Numbers
| None |
| Name
| N-alpha-acetyltransferase 11 |
| Synonyms
|
- N-terminal acetyltransferase complex ARD1 subunit homolog B
- NatA catalytic subunit
- hARD2
|
| Gene Name
| NAA11 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| In complex with NAA15, displays alpha (N-terminal) acetyltransferase activity.
|
| Pathways
|
Not Available
|
| Reactions
|
| Acetyl-CoA + peptide → N(alpha)-acetylpeptide + Coenzyme A |
details
|
|
| GO Classification
|
| Cellular Component |
| nucleus |
| Golgi apparatus |
| centrosome |
| Molecular Function |
| peptide alpha-N-acetyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 4 |
| Locus
| 4q21.21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 25978.61 |
| Theoretical pI
| 5.176 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|14249280|ref|NP_116082.1| N-alpha-acetyltransferase 11 [Homo sapiens]
MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWPQLSYIAEDEDGKIVGYVLAKM
EEEPDDVPHG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BSU3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28125 |
| References |
| General References
| Not Available |