Hmdb loader
Identification
HMDB Protein ID HMDBP11834
Secondary Accession Numbers None
Name Mitochondrial pyruvate carrier 1
Synonyms
  1. Brain protein 44-like protein
Gene Name MPC1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Mediates the uptake of pyruvate into mitochondria.
Pathways
  • 2-ketoglutarate dehydrogenase complex deficiency
  • Citric Acid Cycle
  • Congenital lactic acidosis
  • Fructose-1,6-diphosphatase deficiency
  • Fumarase deficiency
  • Gluconeogenesis
  • Glutaminolysis and Cancer
  • Glycogen Storage Disease Type 1A (GSD1A) or Von Gierke Disease
  • Glycogenosis, Type IA. Von gierke disease
  • Glycogenosis, Type IB
  • Glycogenosis, Type IC
  • Mitochondrial complex II deficiency
  • Phosphoenolpyruvate carboxykinase deficiency 1 (PEPCK1)
  • Pyruvate dehydrogenase deficiency (E2)
  • Pyruvate dehydrogenase deficiency (E3)
  • The oncogenic action of 2-hydroxyglutarate
  • The oncogenic action of D-2-hydroxyglutarate in Hydroxygluaricaciduria
  • The Oncogenic Action of Fumarate
  • The oncogenic action of L-2-hydroxyglutarate in Hydroxygluaricaciduria
  • The Oncogenic Action of Succinate
  • Transfer of Acetyl Groups into Mitochondria
  • Triosephosphate isomerase
  • Warburg Effect
Reactions Not Available
GO Classification
Biological Process
transport
Cellular Component
integral to membrane
mitochondrial inner membrane
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6q27
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 12347.37
Theoretical pI 9.615
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7706369|ref|NP_057182.1| mitochondrial pyruvate carrier 1 isoform 1 [Homo sapiens]
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALC
CYSLTFMRFA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9Y5U8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:21606
References
General References Not Available