| Identification |
|---|
| HMDB Protein ID
| HMDBP11834 |
| Secondary Accession Numbers
| None |
| Name
| Mitochondrial pyruvate carrier 1 |
| Synonyms
|
- Brain protein 44-like protein
|
| Gene Name
| MPC1 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Mediates the uptake of pyruvate into mitochondria.
|
| Pathways
|
- 2-ketoglutarate dehydrogenase complex deficiency
- Citric Acid Cycle
- Congenital lactic acidosis
- Fructose-1,6-diphosphatase deficiency
- Fumarase deficiency
- Gluconeogenesis
- Glutaminolysis and Cancer
- Glycogen Storage Disease Type 1A (GSD1A) or Von Gierke Disease
- Glycogenosis, Type IA. Von gierke disease
- Glycogenosis, Type IB
- Glycogenosis, Type IC
- Mitochondrial complex II deficiency
- Phosphoenolpyruvate carboxykinase deficiency 1 (PEPCK1)
- Pyruvate dehydrogenase deficiency (E2)
- Pyruvate dehydrogenase deficiency (E3)
- The oncogenic action of 2-hydroxyglutarate
- The oncogenic action of D-2-hydroxyglutarate in Hydroxygluaricaciduria
- The Oncogenic Action of Fumarate
- The oncogenic action of L-2-hydroxyglutarate in Hydroxygluaricaciduria
- The Oncogenic Action of Succinate
- Transfer of Acetyl Groups into Mitochondria
- Triosephosphate isomerase
- Warburg Effect
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| transport |
| Cellular Component |
| integral to membrane |
| mitochondrial inner membrane |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 6 |
| Locus
| 6q27 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 12347.37 |
| Theoretical pI
| 9.615 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|7706369|ref|NP_057182.1| mitochondrial pyruvate carrier 1 isoform 1 [Homo sapiens]
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALC
CYSLTFMRFA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9Y5U8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21606 |
| References |
|---|
| General References
| Not Available |
