| Identification |
| HMDB Protein ID
| HMDBP11833 |
| Secondary Accession Numbers
| None |
| Name
| Mitochondrial pyruvate carrier 1-like protein |
| Synonyms
|
Not Available
|
| Gene Name
| MPC1L |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Not Available |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Cellular Component |
| integral to membrane |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| X |
| Locus
| Xp11.4 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 15137.395 |
| Theoretical pI
| 9.933 |
| Pfam Domain Function
|
|
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|306922396|ref|NP_001182451.1| mitochondrial pyruvate carrier 1-like protein [Homo sapiens]
MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTA
LILYSAIFMR
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P0DKB6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:44205 |
| References |
| General References
| Not Available |