| Identification |
| HMDB Protein ID
| HMDBP11830 |
| Secondary Accession Numbers
| None |
| Name
| tRNA dimethylallyltransferase, mitochondrial |
| Synonyms
|
- Isopentenyl-diphosphate:tRNA isopentenyltransferase
- hGRO1
- tRNA isopentenyltransferase
- IPP transferase
- IPPT
- IPTase
|
| Gene Name
| TRIT1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 of both cytosolic and mitochondrial tRNAs, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).
|
| Pathways
|
Not Available
|
| Reactions
|
| Dimethylallylpyrophosphate + tRNA → Pyrophosphate + tRNA containing 6-dimethylallyladenosine |
details
|
| Dimethylallylpyrophosphate + tRNA → Pyrophosphate + tRNA containing 6-isopentenyladenosine |
details
|
|
| GO Classification
|
| Biological Process |
| tRNA processing |
| Cellular Component |
| mitochondrion |
| Molecular Function |
| metal ion binding |
| ATP binding |
| tRNA dimethylallyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 1 |
| Locus
| 1p34.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 52724.84 |
| Theoretical pI
| 8.201 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|31581534|ref|NP_060116.2| tRNA dimethylallyltransferase, mitochondrial precursor [Homo sapiens]
MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVY
EGLDIITNKV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H3H1 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:20286 |
| References |
| General References
| Not Available |