| Identification |
| HMDB Protein ID
| HMDBP11827 |
| Secondary Accession Numbers
| None |
| Name
| Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C |
| Synonyms
|
- N-acetylglucosaminyltransferase IV homolog
- N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVc
- UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVc
- hGnT-IV-H
- GlcNAc-T IVc
- GnT-IVc
- N-acetylglucosaminyltransferase IVc
|
| Gene Name
| MGAT4C |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N-linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains (By similarity). Does not catalyze the transfer of GlcNAc to the Manalpha1-6 arm to form GlcNAcBeta1-4Manalpha1-6 linkage ('GnT-VI' activity).
|
| Pathways
|
- N-Glycan biosynthesis
- protein glycosylation
|
| Reactions
|
| Uridine diphosphate-N-acetylglucosamine + 3-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R → Uridine 5'-diphosphate + 3-(2,4-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R |
details
|
| UDP-N-acetyl-D-glucosamine + → UDP + |
details
|
|
| GO Classification
|
| Biological Process |
| post-translational protein modification |
| protein N-linked glycosylation via asparagine |
| Cellular Component |
| integral to membrane |
| Golgi membrane |
| Molecular Function |
| metal ion binding |
| alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 12 |
| Locus
| 12q21 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 56060.915 |
| Theoretical pI
| 8.157 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|166197698|ref|NP_037376.2| alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C [Homo sapiens]
MFKFHQMKHIFEILDKMRCLRKRSTVSFLGVLVIFLLFMNLYIEDSYVLEGDKQLIRETS
THQLNSERYV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9UBM8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:30871 |
| References |
| General References
| Not Available |