| Identification |
| HMDB Protein ID
| HMDBP11812 |
| Secondary Accession Numbers
| None |
| Name
| Magnesium transporter protein 1 |
| Synonyms
|
- MagT1
- Implantation-associated protein
- IAP
|
| Gene Name
| MAGT1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| May be involved in N-glycosylation through its association with N-oligosaccharyl transferase. May be involved in Mg(2+) transport in epithelial cells.
|
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| cognition |
| protein N-linked glycosylation |
| Cellular Component |
| integral to plasma membrane |
| oligosaccharyltransferase complex |
| Molecular Function |
| magnesium ion transmembrane transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| X |
| Locus
| Xq21.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 41531.49 |
| Theoretical pI
| 9.942 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|215983058|ref|NP_115497.4| magnesium transporter protein 1 [Homo sapiens]
MRKGKGPICLFSRPTLRPSRSKVSLIEGRGANMAARWRFWCVSVTMVVALLIVCDVPSAS
AQRKKEMVLS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H0U3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:28880 |
| References |
| General References
| Not Available |