| Identification |
| HMDB Protein ID
| HMDBP11806 |
| Secondary Accession Numbers
| None |
| Name
| Phosphatidate phosphatase LPIN2 |
| Synonyms
|
- Lipin-2
|
| Gene Name
| LPIN2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Plays important roles in controlling the metabolism of fatty acids at differents levels. Acts as a magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis in the reticulum endoplasmic membrane. Acts also as a nuclear transcriptional coactivator for PPARGC1A to modulate lipid metabolism (By similarity).
|
| Pathways
|
- Glycerolipid metabolism
- Glycerophospholipid metabolism
|
| Reactions
|
| A 1,2-diacylglycerol 3-phosphate + Water → a 1,2-diacyl-sn-glycerol + Phosphate |
details
|
| Phosphatidate + Water → 1,2-Diacyl-sn-glycerol + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| fatty acid metabolic process |
| triglyceride biosynthetic process |
| transcription, DNA-dependent |
| phosphatidylcholine biosynthetic process |
| phosphatidylethanolamine biosynthetic process |
| positive regulation of transcription from RNA polymerase II promoter |
| Cellular Component |
| endoplasmic reticulum membrane |
| cytosol |
| nucleus |
| Molecular Function |
| transcription coactivator activity |
| phosphatidate phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 18 |
| Locus
| 18p11.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 99398.355 |
| Theoretical pI
| 5.324 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|7662022|ref|NP_055461.1| phosphatidate phosphatase LPIN2 [Homo sapiens]
MNYVGQLAGQVIVTVKELYKGINQATLSGCIDVIVVQQQDGSYQCSPFHVRFGKLGVLRS
KEKVIDIEIN
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q92539 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:14450 |
| References |
| General References
| Not Available |