| Identification |
| HMDB Protein ID
| HMDBP11802 |
| Secondary Accession Numbers
| None |
| Name
| Katanin p60 ATPase-containing subunit A-like 2 |
| Synonyms
|
- Katanin p60 subunit A-like 2
- p60 katanin-like 2
|
| Gene Name
| KATNAL2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Severs microtubules in vitro in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays (By similarity).
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Cellular Component |
| cytoplasm |
| microtubule |
| Molecular Function |
| ATP binding |
| microtubule-severing ATPase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 18 |
| Locus
| 18q21.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 52780.635 |
| Theoretical pI
| 8.323 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|226371754|ref|NP_112593.2| katanin p60 ATPase-containing subunit A-like 2 [Homo sapiens]
MEYESYYFVKFQKYPKIVKKSSDTAENNLPQRSRGKTRRMMNDSCQNLPKINQQRPRSKT
TAGKTGDTKS
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8IYT4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:25387 |
| References |
| General References
| Not Available |